<< < 20 21 22 23 24 25 26 27 28 29 30 > >>   Sort: Rank

Molecule FYI-1004355
Molecule Summary: ID: FYI-1004355 Names: InChIKey: LTKUGBDMHOQZJQ-SOFGYWHQSA-N SMILES: C=C(C)NC(=C)/C=C(C)/NC Received at FYIcenter.com on: 2023-09-01
2023-09-07, 143👍, 0💬

Molecule FYI-1004359
Molecule Summary: ID: FYI-1004359 Names: InChIKey: RIDAVZHXMAYCPB-UHFFFAOYSA-N SMILES: O=C(CCCn2nnc(c1ccccn1)n2)Nc3cc c(F)c(Cl)c3Received at FYIcenter.com on: 2023-09-01
2023-09-07, 141👍, 0💬

Molecule FYI-1004351
Molecule Summary: ID: FYI-1004351 Names: InChIKey: XOAXMMIFZLIULY-ONEGZZNKSA-N SMILES: CN/C=C/CNC(C)=O Received at FYIcenter.com on: 2023-09-01
2023-09-07, 139👍, 0💬

Molecule FYI-1004356
Molecule Summary: ID: FYI-1004356 Names: InChIKey: VBORPXBRUDYUOY-UHFFFAOYSA-N SMILES: COc4ccc(F)c(c3ccc(C)c(C(=O)Nc1 ccc(OC(F)(F)F)cc1S(=O)(=O)NC(= O)C2CC2)n3)c4Received at FYIcenter.com on: 2023-09-01
2023-09-07, 132👍, 0💬

PK AUC Calculation
Where to find FAQ (Frequently Asked Questions) on PK AUC Calculation? Here is a list of tutorials to answer many frequently asked questions compiled by FYIcenter.com team on PK AUC Calculation. Single Dose AUC Calculation Single Dose PK Dataset Trapezoidal PK AUC Model Trapezoidal Approximation PK A...
2023-09-05, 566👍, 0💬

List of PK (Pharmacokinetics) Symbols
Where Can I find all PK (Pharmacokinetics) symbols? Here is a list of PK (Pharmacokinetics) symbols: A - Amount, representing the amount of drug in the body. AUC - Area Under the Curve, representing the area under plasma concentration-time curve from dose time to infinity. C - Concentration, represe...
2023-09-05, 420👍, 0💬

What Is PD (Pharmacodynamic)
What Is PD (Pharmacodynamic)? PD (Pharmacodynamic) observes effect in a body resulting from a certain drug concentration. More precisely, PD describes how a drug affects the body by linking the drug concentration to an efficacy (or safety) metric. In short, PD describes what a drug does to a body. H...
2023-09-05, 415👍, 0💬

Download 3Dmol.js Source Code
How to download the source code of the 3Dmol.js library locally? If you are interested in reading the source code, examples and other resources of the 3Dmol.js library, you can follow these steps to download the source code package. 1. Go to 3Dmol.js Official Release Website . 2. Click "Source code ...
2023-09-05, 241👍, 0💬

Chemical Element #59: Praseodymium (Pr)
Atomic Number: 59, Element Symbol: Pr, Element Name: Praseodymium, Atomic Mass: 140.9077 u.
2023-09-05, 118👍, 0💬

Chemical Element #58: Cerium (Ce)
Atomic Number: 58, Element Symbol: Ce, Element Name: Cerium, Atomic Mass: 140.12 u.
2023-09-05, 117👍, 0💬

Chemical Element #55: Cesium (Cs)
Atomic Number: 55, Element Symbol: Cs, Element Name: Cesium, Atomic Mass: 132.9054520 u.
2023-09-05, 115👍, 0💬

Chemical Element #62: Samarium (Sm)
Atomic Number: 62, Element Symbol: Sm, Element Name: Samarium, Atomic Mass: 150.4 u.
2023-09-05, 115👍, 0💬

Chemical Element #57: Lanthanum (La)
Atomic Number: 57, Element Symbol: La, Element Name: Lanthanum, Atomic Mass: 138.9055 u.
2023-09-05, 114👍, 0💬

Chemical Element #60: Neodymium (Nd)
Atomic Number: 60, Element Symbol: Nd, Element Name: Neodymium, Atomic Mass: 144.24 u.
2023-09-05, 114👍, 0💬

Chemical Element #56: Barium (Ba)
Atomic Number: 56, Element Symbol: Ba, Element Name: Barium, Atomic Mass: 137.33 u.
2023-09-05, 113👍, 0💬

Chemical Element #61: Promethium (Pm)
Atomic Number: 61, Element Symbol: Pm, Element Name: Promethium, Atomic Mass: 144.91276 u.
2023-09-05, 112👍, 0💬

Scan Prosite Databas with Bio.ExPASy.ScanProsite.scan()
How to Scan Prosite Databas with Bio.ExPASy.ScanProsite.scan() function? Bio.ExPASy.ScanProsite.scan() function allows to scan the Prosite database with a given sequence. Here is an example on how to Scan Prosite Databas. fyicenter$ python &gt;&gt;&gt; from Bio.ExPASy import ScanProsite ...
2023-09-05, 202👍, 0💬

Read Sequence Alignments with Bio.AlignIO
How to Read Sequence Alignments with Bio.AlignIO package? Bio.AlignIO module allows you to read and write Sequence Alignments as MultipleSeqAlignment objects. Enter the following sequence alignment file, PF05371_seed.faa, in FASTA format. &gt;COATB_BPIKE/30-81 AEPNAATNYATEAMDSLKTQAIDLISQTWP VVTTV...
2023-09-05, 201👍, 0💬

Molecule FYI-1003962
Molecule Summary: ID: FYI-1003962 Names: InChIKey: NJWNRPURGQZHRD-UHFFFAOYSA-N SMILES: C=CC(=O)OC4CN(c3ccc(Nc2nc(NC1C COCC1)c(CC)nc2C(N)=O)cc3OC)CCC 4N5CCN(C)CC5Received at FYIcenter.com on: 2023-08-07
2023-09-05, 177👍, 0💬

Molecule FYI-1003562
Molecule Summary: ID: FYI-1003562 Names: InChIKey: OOXSRDOULFVLSF-UHFFFAOYSA-N SMILES: Cc3ccc2[nH]c(SCc1ncccc1F)nc2c3 Received at FYIcenter.com on: 2023-07-03
2023-09-05, 176👍, 0💬

Molecule FYI-1003956
Molecule Summary: ID: FYI-1003956 Names: InChIKey: KLALVMPTCMWTDI-UHFFFAOYSA-N SMILES: CCc4nc(C(N)=O)c(Nc3ccc(N2CCC(N 1CCN(C)CC1N=C=S)CC2)c(OC)c3)nc 4NC5CCOCC5Received at FYIcenter.com on: 2023-08-07
2023-09-05, 176👍, 0💬

Molecule FYI-1004046
Molecule Summary: ID: FYI-1004046 Names: InChIKey: YAVZHCFFUATPRK-YZPBMOCRSA-N SMILES: CC[C@H]3OC(=O)[C@H](C)[C@@H](O [C@H]1C[C@@](C)(OC)[C@@H](O)[C @H](C)O1)[C@H](C)[C@@H](O[C@@H ]2O[C@H](C)C[C@H](N(C)C)[C@H]2 O)[C@](C)(O)C[C@@H](C)C(=O)[C@ H](C)[C@@H](O)[C@]3(C)O.CCCCCC CCCCCCCCCCCC(=O)OReceived at FYI...
2023-09-05, 176👍, 0💬

Molecule FYI-1003976
Molecule Summary: ID: FYI-1003976 Names: InChIKey: SOBPKJYDSKIMNI-UHFFFAOYSA-N SMILES: O=N(=O)c4ccc(CSc3nnc(c2ccc1ncc cc1c2)o3)cc4Received at FYIcenter.com on: 2023-08-08
2023-09-05, 174👍, 0💬

Molecule FYI-1003985
Molecule Summary: ID: FYI-1003985 Names: InChIKey: PBVWEAQUBPTRHW-UHFFFAOYSA-N SMILES: Cc4ccc3cc(c2nnc(SCc1cccc(F)c1) o2)ccc3n4Received at FYIcenter.com on: 2023-08-08
2023-09-05, 174👍, 0💬

<< < 20 21 22 23 24 25 26 27 28 29 30 > >>   Sort: Rank