Atom Biology General Molecule Reaction Tools Trial Virus

<< < … 5 6 7 8 9 10 11 12 13 > >>   ∑:312  Sort:Date

addBox() - Create 3D Boxes
How to create 3D Boxes with 3Dmol.js addBox() methods? viewer.addBox() method in the $3Dmol.GLViewer class allows you to create 3D box objects. Here is the signature of the addBox() method: {$3Dmol.GLViewer} addBox({BoxSpec} spec) -&gt; {$3Dmol.GLShape} Here is an HTML code example, Draw-Box.htm... 2023-09-07, 1047🔥, 0💬

BioJava Library Installation Options
What are installation options for BioJava Library? There are several ways to install BioJava Library. 1. Using "Maven" build tool - Add BioJava as a dependency to your project pom.xml file: &lt;dependencies&gt; &lt;dependency&gt; &lt;groupId&gt;org.bio java&lt;/groupId&... 2023-04-25, 1045🔥, 0💬

Using Embedded 3Dmol Viewer
Where to find FAQ (Frequently Asked Questions) on Using Embedded 3Dmol Viewer? Here is a list of tutorials to answer many frequently asked questions compiled by FYIcenter.com team on Using Embedded 3Dmol Viewer. What Is Embedded 3Dmol Viewer Assign Embedded 3Dmol Viewer to DIV Multiple Selections wi... 2023-02-05, 1041🔥, 0💬

addModel() - Add Model from Data
How to create a model from a molecule data string with 3Dmol.js addModel() methods? viewer.addModel() method in the $3Dmol.GLViewer class allows you to create a model from molecule data string: {$3Dmol.GLViewer} addModel(data, format, options) -&gt; {$3Dmol.GLModel} Here is an HTML code example,... 2023-01-11, 1040🔥, 0💬

addLabel() - Create Text Labels
How to create text labels with 3Dmol.js addSphere() methods? viewer.addSphere() method in the $3Dmol.GLViewer class allows you to create sphere objects. Here is the signature of the addSphere() method: {$3Dmol.GLViewer} addLabel(text, {LabelSpec} options, {AtomSelection} sel) -&gt; {$3Dmol.Label... 2023-09-07, 1038🔥, 0💬

What Is Embedded 3Dmol Viewer
What Is Embedded 3Dmol Viewer? Embedded 3Dmol Viewer is a built-in 3Dmol viewer in the 3Dmol.js library. You can assign the Embedded 3Dmol Viewer to a DIV element in your HTML document using a special "class=viewer_3Dmoljs" attribute. Molecule data, display styles and other options can be specified ... 2023-02-05, 1035🔥, 0💬

editor.structSelected() - Get Selected Sub-Structure
How to get the selected sub-structure currently in the Ketcher editor with the editor.structSelected() method? If you want to get detailed information about the selected sub-structure currently in the Ketcher editor, you can use the editor.structSelected() method on the Ketcher Editor interface. Her... 2023-11-23, 1028🔥, 0💬

UI Components of Online 3Dmol Viewer
What functions are supported by UI components on the Online 3Dmol Viewer? UI components on the Online 3Dmol Viewer support the following functions: 1. Model Data Input: Accessible through the "File/PDB/URL" menu item. You can load PDB protein data from the online PDB database, molecule compound data... 2023-09-10, 1026🔥, 0💬

Ketcher File Format for Chemical Structures
Where to find FAQ (Frequently Asked Questions) on Ketcher File Format for Chemical Structures? Here is a list of tutorials to answer many frequently asked questions compiled by FYIcenter.com team on Ketcher File Format for Chemical Structures. What Is Ketcher File Format Ketcher File Structure Expor... 2024-02-11, 1022🔥, 0💬

editor.struct() - Get Entire Structure
How to get the entire structure currently in the Ketcher editor with the editor.struct() method? If you want to get detailed information about the entire structure currently in the Ketcher editor, you can call the editor.struct() method on the Ketcher Editor interface. Here is an HTML document that ... 2023-12-08, 1020🔥, 0💬

Restore Structure from Server to Ketcher
How to restore a chemical structure from the Web server to the Ketcher editor? If you want to build a chemical structure editor with the capability to save the structure on the Web server and restore it later to the Ketcher, you should follow steps described below: 1. Using JavaScript to export the ... 2023-10-11, 1019🔥, 0💬

Import Ketcher File to Editor
How to import Ketcher file to the Ketcher editor? If you created a Ketcher file, you can verify it by importing it to the Ketcher editor as described below: 1. Create a Ketcher file, cyclobutane.ket, with a text editor: { "root": { "nodes": [ { "$ref": "mol0" } ] }, "mol0": { "type": "molecule", "at... 2024-03-23, 1017🔥, 0💬

Assign Embedded 3Dmol Viewer to DIV
How to assign Embedded 3Dmol Viewer to a "div" element? Here is an HTML code example, Embedded-Viewer-PDB.html, that assigns the Embedded 3Dmol Viewer to in "div" element. It also uses "data-*" attributes to load a protein from the PDB Websites, creates a selection from chain A and displays it in ca... 2023-02-04, 1009🔥, 0💬

Install Biopython
How to install Biopython? The easiest way to install Biopython is to use the "pip" command as shown below. 1. Make sure that Python 3 is installed. fyicenter$ python --version Python 3.8.8 2. Install Biopython. fyicenter$ pip install biopython Requirement already satisfied: numpy in ... Installing c... 2023-02-04, 1005🔥, 0💬

indigo.calculate() - Calculates Chemical Properties
How to calculate chemical properties of a given structure with the indigo.calculate() method? If you want to calculate chemical properties like mass and weight of a given chemical structure you can use the indigo.calculate() method on the Ketcher Indigo interface. Here is an HTML document that shows... 2023-11-09, 996🔥, 0💬

Install JSME 2017-02-26 Version
How to download and install JSME? If you want to try JSME on your own computer, you can follow this tutorial to download and install it. 1. Go to JSME Website at https://www.peter-ertl.com/jsm e/. 2. Click "Download the JSME 2017-02-26" to start downloading. 3. Save the download file as "JSME_2017-0... 2023-01-18, 992🔥, 0💬

Fetch Sequences from SwissProt with Bio.ExPASy.get_sprot_raw()
How to Fetch Sequences from SwissProt with Bio.ExPASy.get_sprot_raw() function? SwissProt with Bio.ExPASy.get_sprot_raw() function allows you to fetch protein sequences from SwissProt database. Here is an example on how to Fetch Sequences from SwissProt. fyicenter$ python &gt;&gt;&gt; fr... 2023-09-10, 982🔥, 0💬

mRNA, Protein and Translation
How to derive protein sequence from a mRNA sequence? Biologically, the protein sequence is produced by a translation process from a mRNA sequence. We can simulate this biological translation process using the translation() function. fyicenter$ python &gt;&gt;&gt; from Bio.Seq import Seq ... 2023-03-17, 981🔥, 0💬

What Is BioJava
What is BioJava? BioJava is a open-source Java library for bioinformatics. BioJava versions and release dates are: BioJava 6.1.0 BioJava 6.0.0 BioJava 5.3.0 BioJava 5.2.0 BioJava 5.0.0 BioJava 4.2.9 BioJava 4.2.1 BioJava 4.2.0 BioJava legacy 1.9.1 Main modules of BioJava: The Core Module (biojava-co... 2023-04-26, 978🔥, 0💬

Fetch Sequences from NCBI with Bio.Entrez.efetch()
How to Fetch Sequences from NCBI with the Bio.Entrez.efetch() function? Bio.Entrez.efetch() function allows you to fetch DNA or protein sequences from NCBI databases: PubMed, GenBank, GEO, and many others. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. Here is an example on how to... 2023-08-25, 976🔥, 0💬

Export Ketcher File from Editor
How to export structure from Ketcher editor in Ketcher file format? The best way to learn the Ketcher file format is to export different types of chemical structures for the Ketcher editor in Ketcher file format as described below: 1. Open Ketcher editor as shown in previous tutorials. 2. Select the... 2024-03-23, 973🔥, 0💬

Adding Text Labels in Ketcher File
How to add text labels in a Ketcher file? You can insert a "text" object structure into the "nodes" array to add a text label in a Ketcher file as shown below: { "type": "text", "data": { "content": &lt;text-definition&gt ;,"position": &lt;location-object&gt ;,"pos": &lt;bounding... 2024-02-28, 973🔥, 0💬

Read Sequence Alignments with Bio.AlignIO
How to Read Sequence Alignments with Bio.AlignIO package? Bio.AlignIO module allows you to read and write Sequence Alignments as MultipleSeqAlignment objects. Enter the following sequence alignment file, PF05371_seed.faa, in FASTA format. &gt;COATB_BPIKE/30-81 AEPNAATNYATEAMDSLKTQAIDLISQTWP VVTTV... 2023-09-05, 967🔥, 0💬

addSphere() - Create Spheres
How to create spheres with 3Dmol.js addSphere() methods? viewer.addSphere() method in the $3Dmol.GLViewer class allows you to create sphere objects. Here is the signature of the addSphere() method: {$3Dmol.GLViewer} addSphere({SphereStyleSpec} spec) -&gt; {$3Dmol.GLShape} Here is an HTML code ex... 2023-09-07, 961🔥, 0💬

<< < … 5 6 7 8 9 10 11 12 13 > >>   ∑:312  Sort:Date

Atom Biology General Molecule Reaction Tools Trial Virus