Atom Biology General Molecule Reaction Tools Trial Virus

<< < 1 2 3   ∑:57  Sort:Date

BioPerl - Perl Bioinformatics Toolkit
Where to find FAQ (Frequently Asked Questions) on BioPerl - Perl toolkit for computational molecular biology? Here is a list of tutorials to answer many frequently asked questions compiled by FYIcenter.com team on BioPerl - Perl toolkit for computational molecular biology. What Is BioPerl BioPerl Mo... 2023-04-17, 292🔥, 0💬

Global Query on All NCBI Databases with Bio.Entrez.egquery()
How to Global Query on All NCBI Databases with Bio.Entrez.egquery() function? Bio.Entrez.egquery() function allows you to perform a global search on all NCBI Databases for a given key word. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. Here is an example on how to do a global sea... 2023-08-25, 290🔥, 0💬

Fetch Sequences from NCBI with Bio.Entrez.efetch()
How to Fetch Sequences from NCBI with the Bio.Entrez.efetch() function? Bio.Entrez.efetch() function allows you to fetch DNA or protein sequences from NCBI databases: PubMed, GenBank, GEO, and many others. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. Here is an example on how to... 2023-08-25, 288🔥, 0💬

What Is Sequence Motif Analysis
What is Sequence Motif Analysis? In biology, a sequence motif is a nucleotide or amino-acid sequence pattern that is widespread and usually assumed to be related to biological function of the macromolecule. For example, an N-glycosylation site motif can be defined as Asn, followed by anything but Pr... 2023-07-11, 288🔥, 0💬

mRNA, Protein and Translation
How to derive protein sequence from a mRNA sequence? Biologically, the protein sequence is produced by a translation process from a mRNA sequence. We can simulate this biological translation process using the translation() function. fyicenter$ python &gt;&gt;&gt; from Bio.Seq import Seq ... 2023-03-17, 288🔥, 0💬

Search History with Bio.Entrez for Subsequent Calls
How to Use Search History with Bio.Entrez for Subsequent Calls? If use Bio.Entrez.esearch() and found a large number of matches, you can use the history feature to retrieve matched records in multiple sequence Bio.Entrez.efetch() calls. 1. Turn on the history feature in the esearch() call with the u... 2023-09-10, 287🔥, 0💬

Read Sequence Alignments with Bio.AlignIO
How to Read Sequence Alignments with Bio.AlignIO package? Bio.AlignIO module allows you to read and write Sequence Alignments as MultipleSeqAlignment objects. Enter the following sequence alignment file, PF05371_seed.faa, in FASTA format. &gt;COATB_BPIKE/30-81 AEPNAATNYATEAMDSLKTQAIDLISQTWP VVTTV... 2023-09-05, 283🔥, 0💬

Retrieve Record Summary with Bio.Entrez.esummary()
How to Retrieve Record Summary with Bio.Entrez.esummary() function? Bio.Entrez.esummary() function allows you to retrieve summary information of a given record in a given NCBI Databas. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. 1. Retrieve summary information from the "nlmcata... 2023-08-09, 281🔥, 0💬

Double Stranded DNA, mRNA and Transcription
What are Double Stranded DNA and mRNA sequences? A Double Stranded DNA sequence actually contains two nucleotide strands. Here is a made-up example: DNA coding strand (aka Crick strand, strand +1) 5' ATGGCCATTGTAATGGGCCGCTGAAAGGGT GCCCGATAG3' DNA template strand (aka Watson strand, strand −1) which ... 2023-03-17, 269🔥, 0💬

<< < 1 2 3   ∑:57  Sort:Date

Atom Biology General Molecule Reaction Tools Trial Virus