1 2 3 > >>   ∑:57  Sort:Rank

Install BioPerl Package Manually
How to install BioPerl package manually? I am having trouble using the "cpan/cpanm" command. If you are having problems using the "cpan/cpanm" command, you can following this tutorial to install the BioPerl 1.7.7 distribution package manually. 1. Go to metacpan.org/pod/BioPerl . 2. Click "Download (...
2024-02-05, 1357🔥, 2💬

Fetch Sequences from SwissProt with Bio.ExPASy.get_sprot_raw()
How to Fetch Sequences from SwissProt with Bio.ExPASy.get_sprot_raw() function? SwissProt with Bio.ExPASy.get_sprot_raw() function allows you to fetch protein sequences from SwissProt database. Here is an example on how to Fetch Sequences from SwissProt. fyicenter$ python >>> fr...
2023-09-10, 1186🔥, 0💬

Search History with Bio.Entrez for Subsequent Calls
How to Use Search History with Bio.Entrez for Subsequent Calls? If use Bio.Entrez.esearch() and found a large number of matches, you can use the history feature to retrieve matched records in multiple sequence Bio.Entrez.efetch() calls. 1. Turn on the history feature in the esearch() call with the u...
2023-09-10, 1137🔥, 0💬

Scan Prosite Database with Bio.ExPASy.ScanProsite.scan()
How to Scan Prosite Database with Bio.ExPASy.ScanProsite.scan() function? Bio.ExPASy.ScanProsite.scan() function allows to scan the Prosite database with a given sequence. Here is an example on how to Scan Prosite Database. fyicenter$ python >>> from Bio.ExPASy import ScanProsit...
2023-09-05, 1944🔥, 0💬

Read Sequence Alignments with Bio.AlignIO
How to Read Sequence Alignments with Bio.AlignIO package? Bio.AlignIO module allows you to read and write Sequence Alignments as MultipleSeqAlignment objects. Enter the following sequence alignment file, PF05371_seed.faa, in FASTA format. >COATB_BPIKE/30-81 AEPNAATNYATEAMDSLKTQAIDLISQTWP VVTTV...
2023-09-05, 1147🔥, 0💬

Fetch Sequences from NCBI with Bio.Entrez.efetch()
How to Fetch Sequences from NCBI with the Bio.Entrez.efetch() function? Bio.Entrez.efetch() function allows you to fetch DNA or protein sequences from NCBI databases: PubMed, GenBank, GEO, and many others. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. Here is an example on how to...
2023-08-25, 2143🔥, 0💬

Search for Related Items in NCBI with Bio.Entrez.elink()
How to Search for Related Items in NCBI with Bio.Entrez.elink() function? Bio.Entrez.elink() function allows you to find related items in a NCBI database for a given record. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. Here is an example on how to find related items with the Bio...
2023-08-25, 1573🔥, 0💬

Global Query on All NCBI Databases with Bio.Entrez.egquery()
How to Global Query on All NCBI Databases with Bio.Entrez.egquery() function? Bio.Entrez.egquery() function allows you to perform a global search on all NCBI Databases for a given key word. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. Here is an example on how to do a global sea...
2023-08-25, 1004🔥, 0💬

Retrieve Record Summary with Bio.Entrez.esummary()
How to Retrieve Record Summary with Bio.Entrez.esummary() function? Bio.Entrez.esummary() function allows you to retrieve summary information of a given record in a given NCBI Databas. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. 1. Retrieve summary information from the "nlmcata...
2023-08-09, 1333🔥, 0💬

Search NCBI Databases with Bio.Entrez.esearch()
How to Search NCBI Databases with Bio.Entrez.esearch() function? Bio.Entrez.esearch() function allows you to search NCBI Databases with a given criteria. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. 1. Search in PubMed for publications that include Biopython in their title. It r...
2023-08-09, 1048🔥, 0💬

Pre-defined Sequence Alignment Score Settings
How to Use Pre-defined Sequence Alignment Score Settings? Biopython provides 3 Pre-defined Sequence Alignment Score Settings: "blastn" and "megablast" for nucleotide alignments, and "blastp" for protein alignments. Here is an example on how to "blastp" score settings. fyicenter$ python >&...
2023-08-03, 1274🔥, 0💬

Calculate Substitutions in Alignments
How to Calculate Substitutions in Sequence Alignments? The substitutions property of an alignment reports how often letters in the alignment are substituted for each other. This is calculated by taking all pairs of rows in the alignment, counting the number of times two letters are aligned to each o...
2023-08-03, 1195🔥, 0💬

Biopython for Sequence Motif Analysis
Where to find FAQ (Frequently Asked Questions) on Biopython for Sequence Motif Analysis? Here is a list of tutorials to answer many frequently asked questions compiled by FYIcenter.com team on Biopython for Sequence Motif Analysis. What Is Sequence Motif Analysis Create Motif With Biopython Bio.moti...
2023-07-29, 1420🔥, 0💬

Get Help Documentation with Biopython
How to Get Help Documentation with Biopython? Biopython has help documentations built in the library. You can use the help() to read them. Read help documentation on Biopython library. fyicenter$ python >>> import Bio >>> help(Bio) Help on package Bio: NAME ...
2023-07-29, 1025🔥, 0💬

Create Motif With Biopython Bio.motifs Module
How to Create Motif With Biopython Bio.motifs Module? Biopython Bio.motifs Module allows you to create a motif object with a list of DNA or protein sequences. A motif object actually represents a sample set of sequences that matches a sequence motif pattern. 1. Create a motif object with a single se...
2023-07-11, 1207🔥, 0💬

What Is Sequence Motif Analysis
What is Sequence Motif Analysis? In biology, a sequence motif is a nucleotide or amino-acid sequence pattern that is widespread and usually assumed to be related to biological function of the macromolecule. For example, an N-glycosylation site motif can be defined as Asn, followed by anything but Pr...
2023-07-11, 1172🔥, 0💬

Play with the ls_orchid.fasta File
How to download and process ls_orchid.fasta file? ls_orchid.fasta file is an example of DNA sequence file in FASTA format provided in the Biopython source code package. You can also download it and use it to test Biopython library. 1. Download ls_orchid.fasta. fyicenter$ curl https://raw.githubuserc...
2023-07-08, 1552🔥, 0💬

List NCBI Databases with Bio.Entrez.einfo()
How to List NCBI Databases with Bio.Entrez.einfo() function? Bio.Entrez.einfo() function allows you to list NCBI Databases and their related information. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. 1. Get a list of NCBI databases. fyicenter$ python >>> from...
2023-07-08, 1230🔥, 0💬

Read Motif in JASPAR Format with Bio.motifs
How to Read Motif in JASPAR Format with Bio.motifs Module? The Bio.motifs.read() function allows to read motif files in several formats including JASPAR. 1. Download motif file in JASPER format by going to https://jaspar.genereg.net/mat rix/MA0080.5/and clicking the "JASPAR" download button. You see...
2023-07-05, 1398🔥, 0💬

Motif Counts and Consensus with Bio.motifs
How to Get Motif Counts and Consensus with Bio.motifs Module? Motif counts represent how often each letter appears at each position in a motif sample set. Motif counts is also called PFM (Position Frequency Matrix). Motif consensus is the sequence of letters along the positions of the motif for whic...
2023-07-05, 1174🔥, 0💬

Motif PCM, PFM, PPM, PWM with Bio.motifs
How to Calculate Motif PCM, PFM, PPM, and PWM with Bio.motifs Module? There are several statistical matrices associated with a sequence motif sample set. PCM (Position Count Matrix) - PCM contains Counts of occurrences of each letter at each position. We can get PCM with "counts" property of a motif...
2023-07-01, 1400🔥, 0💬

Motif PSSM with Bio.motifs
How to Calculate Motif PSSM with Bio.motifs Module? PSSM (Position-Specific Scoring Matrix), also referred as PSWM (Position-Specific Weight Matrix) or LSM (Logodds Scoring Matrix), represents how well the frequency of each letter at each position matches with a given background frequency. PSSM can ...
2023-07-01, 1210🔥, 0💬

Search for Motif Matches with Bio.motifs
How to Search for Matches in a Target Sequence again a motif with Bio.motifs? Bio.motifs module offers two options to search for segments that match a motif in a target sequence. 1. Use the motif instances to search for exact matches. fyicenter$ python >>> from Bio.Seq import Se...
2023-06-19, 1127🔥, 0💬

Compare Motifs Using PSSM with Bio.motifs
How to Compare Motifs Using PSSM with Bio.motifs? If you know PSSMs of two motifs, you can compare them using the PSSM's dist_pearson() function. It returns a position offset for the best alignment and a distance between the two motifs. 1. Create a shorter motif from a given PCM without actual insta...
2023-06-19, 1077🔥, 0💬

1 2 3 > >>   ∑:57  Sort:Rank