Fetch Sequences from SwissProt with Bio.ExPASy.get_sprot_raw()

Q

How to Fetch Sequences from SwissProt with Bio.ExPASy.get_sprot_raw() function?

✍: FYIcenter.com

A

SwissProt with Bio.ExPASy.get_sprot_raw() function allows you to fetch protein sequences from SwissProt database.

Here is an example on how to Fetch Sequences from SwissProt.

fyicenter$ python 
>>> from Bio import ExPASy
>>> from Bio import SeqIO
>>> with ExPASy.get_sprot_raw("O23729") as handle:
...     seq_record = SeqIO.read(handle, "swiss")
... 
>>> print(seq_record)
ID: O23729
Name: CHS3_BROFI
Description: RecName: Full=Chalcone synthase 3; EC=2.3.1.74; AltName: ...
Database cross-references: EMBL:AF007097, AlphaFoldDB:O23729, SMR:O23729, ...
Number of features: 2
/molecule_type=protein
/accessions=['O23729']
/protein_existence=2
/date=15-JUL-1999
/sequence_version=1
/date_last_sequence_update=01-JAN-1998
/date_last_annotation_update=14-DEC-2022
/entry_version=80
/gene_name=[{'Name': 'CHS3'}]
/organism=Bromheadia finlaysoniana (Orchid)
/taxonomy=['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', ...
/ncbi_taxid=['41205']
/comment=FUNCTION: The primary product of this enzyme is 4,2',4',6'- ...
CATALYTIC ACTIVITY: Reaction=4-coumaroyl-CoA + 2 H(+) + 3 malonyl-CoA = ...
PATHWAY: Secondary metabolite biosynthesis; flavonoid biosynthesis.
SIMILARITY: Belongs to the thiolase-like superfamily. Chalcone/stilbene ...
/references=[Reference(title='Molecular cloning and sequence analysis of ...
/keywords=['Acyltransferase', 'Flavonoid biosynthesis', 'Transferase']
Seq('MAPAMEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELK...GAE')

>>> print(seq_record.features[0])
type: CHAIN
location: [0:394]
id: PRO_0000215956
qualifiers:
    Key: note, Value: Chalcone synthase 3

 

Scan Prosite Databas with Bio.ExPASy.ScanProsite.scan()

Search History with Bio.Entrez for Subsequent Calls

Biopython - Tools for Biological Computation

⇑⇑ OBF (Open Bioinformatics Foundation) Tools

2023-09-10, 1120🔥, 0💬