Atom Biology General Molecule Reaction Tools Trial Virus

<< < 1 2 3 4 5 6 7 8 9 … > >>   ∑:309  Sort:Rank

"cid={PubChem_CID}" - Load Molecule from PubMed
How to load a molecule structure with the CID in the Online 3Dmol Viewer? You can use the cid={PubChem_CID} URL parameter to load a molecule structure from https://pubchem.ncbi.nlm.nih.g ov/in the Online 3Dmol Viewer. https://3dmol.org/viewer.html? cid={PubChem_CID}For example, enter the following U... 2023-09-07, 311🔥, 0💬

"new window.ResizeObserver(this.resize)" Error
Why am I getting the "error creating viewer: TypeError: undefined is not a constructor" error at "new window.ResizeObserver(this.res ize)"?If you load a 3Dmol.js HTML file in an older Apple Safari Web browser, you will get the following error in the browser developer console. error creating viewer: ... 2023-09-07, 290🔥, 0💬

"style={...}:..." - Specify Style Attributes
How to Specify Style Attributes using the "style={...}:...,..." URL parameter in the Online 3Dmol Viewer? Style Attributes can be specified as a comma separated list of "key~value" tokens. For example, the following URL provided 3 style attributes for the "carton" style: https://3dmol.org/viewer.htm.. . 2023-09-07, 288🔥, 0💬

What Is Online Server of 3Dmol Viewer
What Is Online Server of 3Dmol Viewer? Online Server of 3Dmol Viewer is an online service provided by University of Pittsburgh. It allows you to view 3-D structures of molecules including proteins interactively using the 3Dmol.js library. Main features of Online Server of 3Dmol Viewer are: support f... 2023-09-07, 288🔥, 0💬

Use of Anonymous Function for 3Dmol.js
Why do some 3Dmol.js examples use anonymous function? There is no reason and no need to include 3Dmol.js code inside an anonymous function. There is no difference between using 3Dmol.js with anonymous function and without anonymous function. For example, the following HTML document, With-Anonymous-F... 2023-09-07, 283🔥, 0💬

URL Parameters for 3Dmol Viewer
What URL Parameters are supported by the Online 3Dmol Viewer? When invoking the Online 3Dmol Viewer, you can add URL parameters to initialize the viewer using this syntax: https://3dmol.org/viewer.html? param1=value1&amp;param2=v alue2&amp;...The 3Dmol Viewer supports the following parameters... 2023-09-07, 277🔥, 0💬

Using Online Server of 3Dmol Viewer
Where to find FAQ (Frequently Asked Questions) on Using Online Server of 3Dmol Viewer? Here is a list of tutorials to answer many frequently asked questions compiled by FYIcenter.com team on Using Online Server of 3Dmol Viewer. What Is Online Server of 3Dmol Viewer URL to Start Online 3Dmol Viewer U... 2023-09-07, 275🔥, 0💬

3Dmol.js Classes and API
Where to find FAQ (Frequently Asked Questions) on 3Dmol.js Classes and API? Here is a list of tutorials to answer many frequently asked questions compiled by FYIcenter.com team on 3Dmol.js Classes and API. $3Dmol Namespace and Static Methods $3Dmol.download('pdb:...', ...) - Download PDB Protein $3D... 2023-09-07, 272🔥, 0💬

"select=..." - Select Substructure in 3Dmol Viewer
How to select substructure in the Online 3Dmol Viewer? You can use the select={Selection} URL parameter to select a substructure in the loaded molecule and specify a different style than the whole molecule. https://3dmol.org/viewer.html? select={Selection}&amp;sty le={Style}&amp;select={Sel ect... 2023-09-07, 269🔥, 0💬

"style={...};{...}" - Specify Multiple Styles
How to Specify Multiple Styles using the "style={...};{...}" URL parameter in the Online 3Dmol Viewer? If you want overlay the selected structure in multiple styles, you can provide a semicolons separated list of styles. For example, the following URL displays the protein structure overlaid in 2 sty... 2023-09-07, 268🔥, 0💬

addLabel() - Create Text Labels
How to create text labels with 3Dmol.js addSphere() methods? viewer.addSphere() method in the $3Dmol.GLViewer class allows you to create sphere objects. Here is the signature of the addSphere() method: {$3Dmol.GLViewer} addLabel(text, {LabelSpec} options, {AtomSelection} sel) -&gt; {$3Dmol.Label... 2023-09-07, 265🔥, 0💬

"surface={...}" - Specify Surface Properties
How to turn on and specify surface properties using the "surface={...}" URL parameter in the Online 3Dmol Viewer? You can use the surface={key:value;key:value;. ..}URL parameter to turn on the Van der Waals surface with given properties. For example, the following URL turns on the Van der Waals surf... 2023-09-07, 263🔥, 0💬

"select=resi:..." - Select Protein Residues by Numbers
How to select Protein Residues by Numbers using the "select=resi:..." URL parameter in the Online 3Dmol Viewer? There are different ways to select Protein Residues by Numbers: select=resi:{number} - Select single residues. select=resi:{number-number} - Select multiple residues in a range. select=res... 2023-09-07, 262🔥, 0💬

Hosting Online 3Dmol Viewer
Where to find FAQ (Frequently Asked Questions) on Hosting Online 3Dmol Viewer? Here is a list of tutorials to answer many frequently asked questions compiled by FYIcenter.com team on Hosting Online 3Dmol Viewer. Install Online 3Dmol Viewer on Linux Start Online 3Dmol Viewer on Linux Code Bug in serv... 2023-09-07, 261🔥, 0💬

addBox() - Create 3D Boxes
How to create 3D Boxes with 3Dmol.js addBox() methods? viewer.addBox() method in the $3Dmol.GLViewer class allows you to create 3D box objects. Here is the signature of the addBox() method: {$3Dmol.GLViewer} addBox({BoxSpec} spec) -&gt; {$3Dmol.GLShape} Here is an HTML code example, Draw-Box.htm... 2023-09-07, 256🔥, 0💬

addSphere() - Create Spheres
How to create spheres with 3Dmol.js addSphere() methods? viewer.addSphere() method in the $3Dmol.GLViewer class allows you to create sphere objects. Here is the signature of the addSphere() method: {$3Dmol.GLViewer} addSphere({SphereStyleSpec} spec) -&gt; {$3Dmol.GLShape} Here is an HTML code ex... 2023-09-07, 252🔥, 0💬

"url={URL}" - Load Molecule from URL
How to load a molecule structure with a given URL in the Online 3Dmol Viewer? You can use the url={URL} URL parameter to load a molecule structure from a given URL in the Online 3Dmol Viewer. https://3dmol.org/viewer.html? url={URL}&amp;type={Type}The type={Type} parameter is needed to specify t... 2023-09-07, 381🔥, 0💬

UI Components of Online 3Dmol Viewer
What functions are supported by UI components on the Online 3Dmol Viewer? UI components on the Online 3Dmol Viewer support the following functions: 1. Model Data Input: Accessible through the "File/PDB/URL" menu item. You can load PDB protein data from the online PDB database, molecule compound data... 2023-09-07, 256🔥, 0💬

Download 3Dmol.js Source Code
How to download the source code of the 3Dmol.js library locally? If you are interested in reading the source code, examples and other resources of the 3Dmol.js library, you can follow these steps to download the source code package. 1. Go to 3Dmol.js Official Release Website . 2. Click "Source code ... 2023-09-05, 315🔥, 0💬

Scan Prosite Database with Bio.ExPASy.ScanProsite.scan()
How to Scan Prosite Database with Bio.ExPASy.ScanProsite.scan() function? Bio.ExPASy.ScanProsite.scan() function allows to scan the Prosite database with a given sequence. Here is an example on how to Scan Prosite Database. fyicenter$ python &gt;&gt;&gt; from Bio.ExPASy import ScanProsit... 2023-09-05, 361🔥, 0💬

Read Sequence Alignments with Bio.AlignIO
How to Read Sequence Alignments with Bio.AlignIO package? Bio.AlignIO module allows you to read and write Sequence Alignments as MultipleSeqAlignment objects. Enter the following sequence alignment file, PF05371_seed.faa, in FASTA format. &gt;COATB_BPIKE/30-81 AEPNAATNYATEAMDSLKTQAIDLISQTWP VVTTV... 2023-09-05, 274🔥, 0💬

Search for Related Items in NCBI with Bio.Entrez.elink()
How to Search for Related Items in NCBI with Bio.Entrez.elink() function? Bio.Entrez.elink() function allows you to find related items in a NCBI database for a given record. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. Here is an example on how to find related items with the Bio... 2023-08-25, 291🔥, 0💬

Global Query on All NCBI Databases with Bio.Entrez.egquery()
How to Global Query on All NCBI Databases with Bio.Entrez.egquery() function? Bio.Entrez.egquery() function allows you to perform a global search on all NCBI Databases for a given key word. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. Here is an example on how to do a global sea... 2023-08-25, 287🔥, 0💬

Fetch Sequences from NCBI with Bio.Entrez.efetch()
How to Fetch Sequences from NCBI with the Bio.Entrez.efetch() function? Bio.Entrez.efetch() function allows you to fetch DNA or protein sequences from NCBI databases: PubMed, GenBank, GEO, and many others. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. Here is an example on how to... 2023-08-25, 282🔥, 0💬

<< < 1 2 3 4 5 6 7 8 9 … > >>   ∑:309  Sort:Rank

Atom Biology General Molecule Reaction Tools Trial Virus